PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g002640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 660aa    MW: 73784.3 Da    PI: 6.4281
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g002640.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3414.31.4e-126383962348
                       XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                       el++rmwkd+++lkrlke++k    ++ a ++++ +++ ++qa rkkmsraQDgiLkYMlk mevcna+GfvYgiip+kgkpv+g+sd++raW
  Sopen01g002640.1  38 ELERRMWKDRVKLKRLKEKQKLA--ARLA-AEKQDNKQVTDQATRKKMSRAQDGILKYMLKLMEVCNARGFVYGIIPDKGKPVSGSSDNIRAW 127
                       9****************999963..4555.8999999******************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT-- CS
              EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgls 187
                       Wkekv+fd+ng aai+ky+a++l+ +++ ++  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWPtG+e ww+++gl+
  Sopen01g002640.1 128 WKEKVKFDKNGLAAIAKYEAECLARGDGVGS--QNGNPQSVLEDLQDATLGSLLSSLMQHCDPPQRKYPLEKGISPPWWPTGDEGWWAKMGLP 218
                       ************************9988888..66999999**************************************************** PP

                       TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX......XXXXXXX CS
              EIN3 188 kdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss......slrkqsp 272
                       k q+ ppy+kphdlkk+wkv+vLtavikhmsp+i++ir+l r+sk+lqdkm+akes ++l+vl++ee+ +++  ++  ss        r +++
  Sopen01g002640.1 219 KGQK-PPYRKPHDLKKMWKVGVLTAVIKHMSPDIAKIRRLIRKSKSLQDKMTAKESSIWLAVLSREEATLQQAGSEngSSsveepaRNRGEKK 310
                       ****.9*****************************************************************9999966335777555555999 PP

                       XXXXXXXXXXXXX.........XXXXXX.XXXXXXXXXX..........XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXX CS
              EIN3 273 kvtlsceqkedve.........gkkeskikhvqavktta..........gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadk 346
                       k  +s+++++dv+                   + +++++          + + ++k + + ++++ + s+ + ++ q sq+ g e +++++d 
  Sopen01g002640.1 311 KPLVSSDSDYDVDitddgigsvS---------SRDERRNhvhplnaipqSHQSTEKGDGHHRRRKRARSNPTEKQIQPSQLHGDEHSNTLPDI 394
                       9999*********6555554441.........33333334555555665555555556566666666666677889*************9998 PP

                       XX CS
              EIN3 347 ns 348
                       ns
  Sopen01g002640.1 395 NS 396
                       87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.0E-12138284No hitNo description
Gene3DG3DSA:1.10.3180.103.6E-68162290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.35E-59165287IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MAVMDEIGID VSSDIEIDDI KCDIAEKDVS DEEIEPNELE RRMWKDRVKL KRLKEKQKLA  60
ARLAAEKQDN KQVTDQATRK KMSRAQDGIL KYMLKLMEVC NARGFVYGII PDKGKPVSGS  120
SDNIRAWWKE KVKFDKNGLA AIAKYEAECL ARGDGVGSQN GNPQSVLEDL QDATLGSLLS  180
SLMQHCDPPQ RKYPLEKGIS PPWWPTGDEG WWAKMGLPKG QKPPYRKPHD LKKMWKVGVL  240
TAVIKHMSPD IAKIRRLIRK SKSLQDKMTA KESSIWLAVL SREEATLQQA GSENGSSSVE  300
EPARNRGEKK KPLVSSDSDY DVDITDDGIG SVSSRDERRN HVHPLNAIPQ SHQSTEKGDG  360
HHRRRKRARS NPTEKQIQPS QLHGDEHSNT LPDINSSKML LAGCITSNSL QGNDKSETTN  420
SVENDLEIQS ELPLQDSNLS LVPSANVVRK EDTYIGAGPS FYPMSQNSAV VPYESEMHLE  480
NQRSIVQHQF QDTQFHGLQK ISGINDGPQI SLSHYEPPNN GLQYGPHSSI THTELQVSEF  540
AHGSQFSNFS QPPVYHSYSS PEFGATHAEP QSHLAHNELH ITPRHSGVGP SLHGSGNDIP  600
KVNHHDGKDM FQNNHDRHID MPFASPLGSP FDLGLDIESH FDNSDYDLDF DKELMSFFAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A8e-711642959140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069598.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_015069608.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-169EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK4ASN10.0K4ASN1_SOLLC; Uncharacterized protein
STRINGSolyc01g006650.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-160ETHYLENE-INSENSITIVE3-like 3